Recombinant Human Ropporin-1B (ROPN1B), partial

Product Description

Recombinant Human Ropporin-1B (ROPN1B), partial is available at Gentaur for Next week Delivery.

Gene Name: ROPN1B

Alternative Names : Rhophilin-associated protein 1B

Expression Region : 1-120aa

AA Sequence : MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE

Sequence Info : Partial of Isoform 2

Tag Info : N-terminal GST-tagged

Theoretical MW : 40.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation.

Involvement in disease :

Subcellular location : Cell projection, cilium, flagellum

Protein Families : Ropporin family

Tissue Specificity :

Paythway :

Uniprot ID : Q9BZX4