Product Description
Recombinant Human Ropporin-1B (ROPN1B) is available at Gentaur for Next week Delivery.
Gene Name: ROPN1B
Alternative Names : Rhophilin-associated protein 1B
Expression Region : 1-120aa
AA Sequence : MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
Sequence Info : Full Length of isoform 2
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 15.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function : Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation.
Involvement in disease :
Subcellular location : Cell projection, cilium, flagellum
Protein Families : Ropporin family
Tissue Specificity :
Paythway :
Uniprot ID : Q9BZX4
 Euro
            
 British Pound
            
 US Dollar