Product Description
Recombinant Human Secreted Ly-6/uPAR-related protein 1 (SLURP1) is available at Gentaur for Next week Delivery.
Gene Name: SLURP1
Alternative Names : ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein Short name: ANUP
Expression Region : 23-103aa
AA Sequence : LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 10.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin.
Function : Has an antitumor activity
Involvement in disease : Mal de Meleda (MDM)
Subcellular location : Secreted
Protein Families :
Tissue Specificity : Granulocytes. Expressed in skin. Predominantly expressed in the granular layer of skin, notably the acrosyringium. Identified in several biological fluids such as sweat, saliva, tears, plasma and urine.
Paythway :
Uniprot ID : P55000
Euro
British Pound
US Dollar