Recombinant Human Secreted Ly-6/uPAR-related protein 1 (SLURP1)

Product Description

Recombinant Human Secreted Ly-6/uPAR-related protein 1 (SLURP1) is available at Gentaur for Next week Delivery.

Gene Name: SLURP1

Alternative Names : ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein Short name: ANUP

Expression Region : 23-103aa

AA Sequence : LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 10.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin.

Function : Has an antitumor activity

Involvement in disease : Mal de Meleda (MDM)

Subcellular location : Secreted

Protein Families :

Tissue Specificity : Granulocytes. Expressed in skin. Predominantly expressed in the granular layer of skin, notably the acrosyringium. Identified in several biological fluids such as sweat, saliva, tears, plasma and urine.

Paythway :

Uniprot ID : P55000