Product Description
Recombinant Human Secretory carrier-associated membrane protein 3 (SCAMP3), partial is available at Gentaur for Next week Delivery.
Gene Name: SCAMP3
Alternative Names :
Expression Region : 2-170aa
AA Sequence : AQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYL
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 45.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.
Function : Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.
Involvement in disease :
Subcellular location : Membrane, Multi-pass membrane protein
Protein Families : SCAMP family
Tissue Specificity : Widely expressed, with highest expression in heart and skeletal muscle.
Paythway :
Uniprot ID : O14828
Euro
British Pound
US Dollar