Recombinant Human Secretory carrier-associated membrane protein 3 (SCAMP3), partial

Product Description

Recombinant Human Secretory carrier-associated membrane protein 3 (SCAMP3), partial is available at Gentaur for Next week Delivery.

Gene Name: SCAMP3

Alternative Names :

Expression Region : 2-170aa

AA Sequence : AQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYL

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 45.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.

Function : Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.

Involvement in disease :

Subcellular location : Membrane, Multi-pass membrane protein

Protein Families : SCAMP family

Tissue Specificity : Widely expressed, with highest expression in heart and skeletal muscle.

Paythway :

Uniprot ID : O14828