Product Description
Recombinant Human Selenoprotein M (SELM) is available at Gentaur for Next week Delivery.
Gene Name: SELM
Alternative Names :
Expression Region : 24-145aa
AA Sequence : ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL
Sequence Info : Full Length of Mature Protein
Tag Info : Tag-Free
Theoretical MW : 13.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.
Function : May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.
Involvement in disease :
Subcellular location : Cytoplasm, perinuclear region, Endoplasmic reticulum, Golgi apparatus
Protein Families : Selenoprotein M/F family
Tissue Specificity : Widely expressed.
Paythway :
Uniprot ID : Q8WWX9
Euro
British Pound
US Dollar