Recombinant Human Selenoprotein M (SELM)

Product Description

Recombinant Human Selenoprotein M (SELM) is available at Gentaur for Next week Delivery.

Gene Name: SELM

Alternative Names :

Expression Region : 24-145aa

AA Sequence : ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 13.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.

Function : May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.

Involvement in disease :

Subcellular location : Cytoplasm, perinuclear region, Endoplasmic reticulum, Golgi apparatus

Protein Families : Selenoprotein M/F family

Tissue Specificity : Widely expressed.

Paythway :

Uniprot ID : Q8WWX9