Euro
British Pound
US Dollar
Product Description
Recombinant Human Sentrin-specific protease 8 (SENP8) is available at Gentaur for Next week Delivery.
Gene Name: SENP8
Alternative Names : Deneddylase-1NEDD8-specific protease 1;Protease, cysteine 2Sentrin/SUMO-specific protease SENP8
Expression Region : 1-212aa
AA Sequence : MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 40.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53.
Function : Protease that catalyzes two essential functions in the NEDD8 pathway
Involvement in disease :
Subcellular location :
Protein Families : Peptidase C48 family
Tissue Specificity : Broadly expressed, with highest levels in kidney and pancreas.
Paythway :
Uniprot ID : Q96LD8
