Recombinant Human Sepiapterin reductase (SPR)

Product Description

Recombinant Human Sepiapterin reductase (SPR) is available at Gentaur for Next week Delivery.

Gene Name: SPR

Alternative Names :

Expression Region : 1-261aa

AA Sequence : MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 32 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the final one or two reductions in tetra-hydrobiopterin biosynthesis to form 5,6,7,8-tetrahydrobiopterin.

Function : Catalyzes the final one or two reductions in tetra-hydrobiopterin biosynthesis to form 5,6,7,8-tetrahydrobiopterin.

Involvement in disease : Dystonia, DOPA-responsive, due to sepiapterin reductase deficiency (DRDSPRD)

Subcellular location : Cytoplasm

Protein Families : Sepiapterin reductase family

Tissue Specificity :

Paythway :

Uniprot ID : P35270