Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PPP2CB)

Product Description

Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PPP2CB) is available at Gentaur for Next week Delivery.

Gene Name: PPP2CB

Alternative Names :

Expression Region : 1-309aa

AA Sequence : MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 62.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.

Function : PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus, Chromosome, centromere, Cytoplasm, cytoskeleton, spindle pole

Protein Families : PPP phosphatase family, PP-1 subfamily

Tissue Specificity :

Paythway : Hipposignalingpathway

Uniprot ID : P62714