Product Description
Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PPP2CB) is available at Gentaur for Next week Delivery.
Gene Name: PPP2CB
Alternative Names :
Expression Region : 1-309aa
AA Sequence : MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 62.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.
Function : PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.
Involvement in disease :
Subcellular location : Cytoplasm, Nucleus, Chromosome, centromere, Cytoplasm, cytoskeleton, spindle pole
Protein Families : PPP phosphatase family, PP-1 subfamily
Tissue Specificity :
Paythway : Hipposignalingpathway
Uniprot ID : P62714
Euro
British Pound
US Dollar