Recombinant Human Small muscular protein (SMPX)

Product Description

Recombinant Human Small muscular protein (SMPX) is available at Gentaur for Next week Delivery.

Gene Name: SMPX

Alternative Names : Stretch-responsive skeletal muscle protein

Expression Region : 1-88aa

AA Sequence : MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 36.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.

Function : Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.

Involvement in disease : Deafness, X-linked, 4 (DFNX4)

Subcellular location :

Protein Families : SMPX family

Tissue Specificity : Preferentially and abundantly expressed in heart and skeletal muscle.

Paythway :

Uniprot ID : Q9UHP9