Recombinant Human Sodium/potassium-transporting ATPase subunit gamma (FXYD2)

Product Description

Recombinant Human Sodium/potassium-transporting ATPase subunit gamma (FXYD2) is available at Gentaur for Next week Delivery.

Gene Name: FXYD2

Alternative Names : FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain

Expression Region : 1-64aa

AA Sequence : MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Sequence Info : Full Length of Isoform 2

Tag Info : N-terminal GST-tagged

Theoretical MW : 34.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.

Function : May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.

Involvement in disease : Hypomagnesemia 2 (HOMG2)

Subcellular location : Membrane, Single-pass type III membrane protein

Protein Families : FXYD family

Tissue Specificity : Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells.

Paythway : cAMPsignalingpathway

Uniprot ID : P54710