Recombinant Human Sperm mitochondrial-associated cysteine-rich protein (SMCP)

Product Description

Recombinant Human Sperm mitochondrial-associated cysteine-rich protein (SMCP) is available at Gentaur for Next week Delivery.

Gene Name: SMCP

Alternative Names :

Expression Region : 1-116aa

AA Sequence : MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 39.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Developmental Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the fale reproductive tract and inability to penetrate the oocyte zona pellucida .

Function : Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the female reproductive tract and inability to penetrate the oocyte zona pellucida (By similarity).

Involvement in disease :

Subcellular location : Cytoplasm, Mitochondrion membrane, Peripheral membrane protein, Cytoplasmic side

Protein Families :

Tissue Specificity : Testis. Is selectively expressed in the spermatids of seminiferous tubules.

Paythway :

Uniprot ID : P49901