Recombinant Human Sperm surface protein Sp17 (SPA17), partial

Product Description

Recombinant Human Sperm surface protein Sp17 (SPA17), partial is available at Gentaur for Next week Delivery.

Gene Name: SPA17

Alternative Names : Cancer/testis antigen 22;CT22Sp17-1Sperm autoantigenic protein 17;Sperm protein 17

Expression Region : 1-146aa

AA Sequence : MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 43.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates .

Function : Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates (By similarity).

Involvement in disease :

Subcellular location : Membrane, Peripheral membrane protein

Protein Families :

Tissue Specificity : Testis and sperm specific.

Paythway :

Uniprot ID : Q15506