Product Description
Recombinant Human Sperm surface protein Sp17 (SPA17), partial is available at Gentaur for Next week Delivery.
Gene Name: SPA17
Alternative Names : Cancer/testis antigen 22;CT22Sp17-1Sperm autoantigenic protein 17;Sperm protein 17
Expression Region : 1-146aa
AA Sequence : MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 43.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates .
Function : Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates (By similarity).
Involvement in disease :
Subcellular location : Membrane, Peripheral membrane protein
Protein Families :
Tissue Specificity : Testis and sperm specific.
Paythway :
Uniprot ID : Q15506
Euro
British Pound
US Dollar