Euro
British Pound
US Dollar
Product Description
Recombinant Human Striated muscle preferentially expressed protein kinase (SPEG), partial is available at Gentaur for Next week Delivery.
Gene Name: SPEG
Alternative Names : Aortic preferentially expressed protein 1;APEG-1
Expression Region : 1-113aa
AA Sequence : MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGAPVAVAGAPVFLRPLKNAAVCAGSDVRLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNE
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 38.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Developmental Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells.
Function : Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells.
Involvement in disease : Myopathy, centronuclear, 5 (CNM5)
Subcellular location : Isoform 3: Nucleus
Protein Families : Protein kinase superfamily, CAMK Ser/Thr protein kinase family
Tissue Specificity : Isoform 1 is preferentially expressed in striated muscle. Non-kinase form such as isoform 3 is predominantly expressed in the aorta. Isoform 3 appears to be expressed only in highly differentiated ASMC in normal vessel walls and down-regulated in dedifferentiated ASMC in vivo. In response to vascular injuries ASMC dedifferentiate and change from a quiescent and contractile phenotype to a proliferative and synthetic phenotype. This proliferation of vascular smooth muscle cells is one of the most prominent features of atherosclerosis.
Paythway :
Uniprot ID : Q15772
