Product Description
Recombinant Human Syndecan-2 (SDC2), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: SDC2
Alternative Names : Syndecan-2; SYND2; Fibroglycan; Heparan Sulfate Proteoglycan Core Protein; HSPG; CD362; SDC2; HSPG1
Expression Region : 19-144aa
AA Sequence : ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE
Sequence Info : Partial
Tag Info : C-terminal 6xHis-tagged
Theoretical MW : 14.98 kDa
Storage Buffer : Lyophilized from a 0.2 ?m Filtered 20 mM Tris-Citrate, 150 mM NaCl, pH 7.0
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined by its ability to bind Human FGFb in functional ELISA is less than 5 ug/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Syndecan-2 is a member of the Syndecans family comprised of type I transmembrane heparan sulfate proteoglycans (HSPG) that are involved in the regulation of many cellular processes. Four sub-types of mammalian Syndecans have been reported and among them. Syndecan-2 plays a role in the cancer development. It can affect the basal and chemotherapy-induced apoptosis in osteosarcoma. It can also suppress MMP2 activation, suppressing metastasis.
Function : Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis (By similarity).
Involvement in disease :
Subcellular location : Membrane, Single-pass type I membrane protein
Protein Families : Syndecan proteoglycan family
Tissue Specificity :
Paythway :
Uniprot ID : P34741
 Euro
 Euro
             British Pound
 British Pound
             US Dollar
 US Dollar
             
             
                 
       
           
           
           
           
          