Recombinant Human Syndecan-2 (SDC2), partial (Active)

Product Description

Recombinant Human Syndecan-2 (SDC2), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: SDC2

Alternative Names : Syndecan-2; SYND2; Fibroglycan; Heparan Sulfate Proteoglycan Core Protein; HSPG; CD362; SDC2; HSPG1

Expression Region : 19-144aa

AA Sequence : ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE

Sequence Info : Partial

Tag Info : C-terminal 6xHis-tagged

Theoretical MW : 14.98 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 20 mM Tris-Citrate, 150 mM NaCl, pH 7.0

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to bind Human FGFb in functional ELISA is less than 5 ug/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Syndecan-2 is a member of the Syndecans family comprised of type I transmembrane heparan sulfate proteoglycans (HSPG) that are involved in the regulation of many cellular processes. Four sub-types of mammalian Syndecans have been reported and among them. Syndecan-2 plays a role in the cancer development. It can affect the basal and chemotherapy-induced apoptosis in osteosarcoma. It can also suppress MMP2 activation, suppressing metastasis.

Function : Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis (By similarity).

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families : Syndecan proteoglycan family

Tissue Specificity :

Paythway :

Uniprot ID : P34741