Product Description
Recombinant Human Tetraspanin-7 (TSPAN7), partial is available at Gentaur for Next week Delivery.
Gene Name: TSPAN7
Alternative Names : Cell surface glycoprotein A15Membrane component chromosome X surface marker 1T-cell acute lymphoblastic leukemia-associated antigen 1;TALLA-1Transmembrane 4 superfamily member 2;; CD231
Expression Region : 113-223aa
AA Sequence : RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGI
Sequence Info : Extracellular Domain
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 14.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May be involved in cell proliferation and cell motility.
Function : May be involved in cell proliferation and cell motility.
Involvement in disease : Mental retardation, X-linked 58 (MRX58)
Subcellular location : Membrane, Multi-pass membrane protein
Protein Families : Tetraspanin (TM4SF) family
Tissue Specificity : Not solely expressed in T-cells. Expressed in acute myelocytic leukemia cells of some patients.
Paythway :
Uniprot ID : P41732
Euro
British Pound
US Dollar