Recombinant Human Tetraspanin-7 (TSPAN7), partial

Product Description

Recombinant Human Tetraspanin-7 (TSPAN7), partial is available at Gentaur for Next week Delivery.

Gene Name: TSPAN7

Alternative Names : Cell surface glycoprotein A15Membrane component chromosome X surface marker 1T-cell acute lymphoblastic leukemia-associated antigen 1;TALLA-1Transmembrane 4 superfamily member 2;; CD231

Expression Region : 113-223aa

AA Sequence : RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGI

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 14.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in cell proliferation and cell motility.

Function : May be involved in cell proliferation and cell motility.

Involvement in disease : Mental retardation, X-linked 58 (MRX58)

Subcellular location : Membrane, Multi-pass membrane protein

Protein Families : Tetraspanin (TM4SF) family

Tissue Specificity : Not solely expressed in T-cells. Expressed in acute myelocytic leukemia cells of some patients.

Paythway :

Uniprot ID : P41732