Recombinant Human Thioredoxin domain-containing protein 12 (TXNDC12)

Product Description

Recombinant Human Thioredoxin domain-containing protein 12 (TXNDC12) is available at Gentaur for Next week Delivery.

Gene Name: TXNDC12

Alternative Names : Endoplasmic reticulum resident protein 18;ER protein 18;ERp18Endoplasmic reticulum resident protein 19;ER protein 19;ERp19Thioredoxin-like protein p19hTLP19

Expression Region : 27-172aa

AA Sequence : HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 32.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Possesses significant protein thiol-disulfide oxidase activity.

Function : Possesses significant protein thiol-disulfide oxidase activity.

Involvement in disease :

Subcellular location : Endoplasmic reticulum lumen

Protein Families :

Tissue Specificity : Widely expressed.

Paythway :

Uniprot ID : O95881