Recombinant Human Thioredoxin-like protein 4B (TXNL4B)

Product Description

Recombinant Human Thioredoxin-like protein 4B (TXNL4B) is available at Gentaur for Next week Delivery.

Gene Name: TXNL4B

Alternative Names : Dim1-like protein

Expression Region : 1-149aa

AA Sequence : MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 44 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G2 transition.

Function : Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G(2) transition.

Involvement in disease :

Subcellular location : Nucleus

Protein Families : DIM1 family

Tissue Specificity :

Paythway :

Uniprot ID : Q9NX01