Product Description
Recombinant Human Thioredoxin-like protein 4B (TXNL4B) is available at Gentaur for Next week Delivery.
Gene Name: TXNL4B
Alternative Names : Dim1-like protein
Expression Region : 1-149aa
AA Sequence : MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 44 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G2 transition.
Function : Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G(2) transition.
Involvement in disease :
Subcellular location : Nucleus
Protein Families : DIM1 family
Tissue Specificity :
Paythway :
Uniprot ID : Q9NX01
Euro
British Pound
US Dollar