Product Description
Recombinant Human Thioredoxin, mitochondrial (TXN2) is available at Gentaur for Next week Delivery.
Gene Name: TXN2
Alternative Names : Thioredoxin-2
Expression Region : 1-166aa
AA Sequence : TTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 38.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Important for the control of mitochondrial reactive oxygen species homeostasis, apoptosis regulation and cell viability. Possesses a dithiol-reducing activity.
Function : Important for the control of mitochondrial reactive oxygen species homeostasis, apoptosis regulation and cell viability. Possesses a dithiol-reducing activity.
Involvement in disease : Combined oxidative phosphorylation deficiency 29 (COXPD29)
Subcellular location : Mitochondrion
Protein Families : Thioredoxin family
Tissue Specificity : Widely expressed in adult (at protein level) and fetal tissues.
Paythway : NOD-likereceptorsignalingpathway
Uniprot ID : Q99757
Euro
British Pound
US Dollar