Recombinant Human Thioredoxin, mitochondrial (TXN2)

Product Description

Recombinant Human Thioredoxin, mitochondrial (TXN2) is available at Gentaur for Next week Delivery.

Gene Name: TXN2

Alternative Names : Thioredoxin-2

Expression Region : 1-166aa

AA Sequence : TTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 38.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Important for the control of mitochondrial reactive oxygen species homeostasis, apoptosis regulation and cell viability. Possesses a dithiol-reducing activity.

Function : Important for the control of mitochondrial reactive oxygen species homeostasis, apoptosis regulation and cell viability. Possesses a dithiol-reducing activity.

Involvement in disease : Combined oxidative phosphorylation deficiency 29 (COXPD29)

Subcellular location : Mitochondrion

Protein Families : Thioredoxin family

Tissue Specificity : Widely expressed in adult (at protein level) and fetal tissues.

Paythway : NOD-likereceptorsignalingpathway

Uniprot ID : Q99757