Recombinant Human Thrombopoietin (THPO) (Active)

Product Description

Recombinant Human Thrombopoietin (THPO) (Active) is available at Gentaur for Next week Delivery.

Gene Name: THPO

Alternative Names : Thrombopoietin;C-mpl ligand;Megakaryocyte colony-stimulating factor;Megakaryocyte growth and development factor;Myeloproliferative leukemia virus oncogene ligand;THPO

Expression Region : 22-353aa

AA Sequence : SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Theoretical MW : 37.3 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a cell proliferation assay using MO7e human megakaryocytic leukemic cells is less than 10 ng/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Thrombopoietin (TPO) is a glycoprotein hormone which belongs to the EPO/TPO family. It produced by the liver and kidney which regulates the production of platelets. TPO stimulates the production and differentiation of megakaryocytes, the bone marrow cells that bud off large numbers of platelets. Lineage-specific cytokine affects the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.

Function : Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.

Involvement in disease : Thrombocythemia 1 (THCYT1)

Subcellular location : Secreted

Protein Families : EPO/TPO family

Tissue Specificity :

Paythway : Jak-STATsignalingpathway

Uniprot ID : P40225