Recombinant Human Thyroid hormone-inducible hepatic protein (THRSP)

Product Description

Recombinant Human Thyroid hormone-inducible hepatic protein (THRSP) is available at Gentaur for Next week Delivery.

Gene Name: THRSP

Alternative Names : Spot 14 protein

Expression Region : 1-146aa

AA Sequence : MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 43.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB.

Function : Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA (By similarity). May function as transcriptional coactivator. May modulate the transcription factor activity of THRB.

Involvement in disease :

Subcellular location : Nucleus, Cytoplasm

Protein Families : SPOT14 family

Tissue Specificity : Mainly expressed in tissues that synthesize triglycerides.

Paythway :

Uniprot ID : Q92748