Recombinant Human Thyroid peroxidase (TPO), partial

Product Description

Recombinant Human Thyroid peroxidase (TPO), partial is available at Gentaur for Next week Delivery.

Gene Name: TPO

Alternative Names :

Expression Region : 19-161aa

AA Sequence : FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 17.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T3 and T4.

Function : Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T(3) and T(4).

Involvement in disease : Thyroid dyshormonogenesis 2A (TDH2A)

Subcellular location : Membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cell surface

Protein Families : Peroxidase family, XPO subfamily

Tissue Specificity :

Paythway : Th17celldifferentiation

Uniprot ID : P07202