Recombinant Human Tissue factor pathway inhibitor (TFPI), partial

Product Description

Recombinant Human Tissue factor pathway inhibitor (TFPI), partial is available at Gentaur for Next week Delivery.

Gene Name: TFPI

Alternative Names : Extrinsic pathway inhibitor;EPILipoprotein-associated coagulation inhibitor;LACI

Expression Region : 29-280aa

AA Sequence : DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGL

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 55.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.

Function : Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.

Involvement in disease :

Subcellular location : Isoform Alpha: Secreted, SUBCELLULAR LOCATION: Isoform Beta: Microsome membrane, Lipid-anchor, GPI-anchor

Protein Families :

Tissue Specificity : Mostly in endothelial cells.

Paythway : Complementandcoagulationcascades

Uniprot ID : P10646