Recombinant Human Toll-like receptor 7 (TLR7), partial

Product Description

Recombinant Human Toll-like receptor 7 (TLR7), partial is available at Gentaur for Next week Delivery.

Gene Name: TLR7

Alternative Names :

Expression Region : 861-1049aa

AA Sequence : HLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTKDPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV

Sequence Info : Partial

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 29.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

Function : Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (By similarity).

Involvement in disease :

Subcellular location : Endoplasmic reticulum membrane, Single-pass type I membrane protein, Endosome, Lysosome, Cytoplasmic vesicle, phagosome

Protein Families : Toll-like receptor family

Tissue Specificity : Detected in brain, placenta, spleen, stomach, small intestine, lung and in plasmacytoid pre-dendritic cells.

Paythway : Toll-likereceptorsignalingpathway

Uniprot ID : Q9NYK1