Product Description
Recombinant Human TP53-regulated inhibitor of apoptosis 1 (TRIAP1) is available at Gentaur for Next week Delivery.
Gene Name: TRIAP1
Alternative Names : Protein 15E1.1 WF-1 p53-inducible cell-survival factor
Expression Region : 1-76aa
AA Sequence : MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 35.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis
Function : Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1
Involvement in disease :
Subcellular location : Cytoplasm, perinuclear region, Mitochondrion, Mitochondrion intermembrane space
Protein Families : TRIAP1/MDM35 family
Tissue Specificity :
Paythway :
Uniprot ID : O43715
Euro
British Pound
US Dollar