Recombinant Human TP53-regulated inhibitor of apoptosis 1 (TRIAP1)

Product Description

Recombinant Human TP53-regulated inhibitor of apoptosis 1 (TRIAP1) is available at Gentaur for Next week Delivery.

Gene Name: TRIAP1

Alternative Names : Protein 15E1.1 WF-1 p53-inducible cell-survival factor

Expression Region : 1-76aa

AA Sequence : MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 35.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis

Function : Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1

Involvement in disease :

Subcellular location : Cytoplasm, perinuclear region, Mitochondrion, Mitochondrion intermembrane space

Protein Families : TRIAP1/MDM35 family

Tissue Specificity :

Paythway :

Uniprot ID : O43715