Recombinant Human Transcription initiation factor IIA subunit 2 (GTF2A2)

Product Description

Recombinant Human Transcription initiation factor IIA subunit 2 (GTF2A2) is available at Gentaur for Next week Delivery.

Gene Name: GTF2A2

Alternative Names : General transcription factor IIA subunit 2 TFIIA p12 subunit

Expression Region : 1-109aa

AA Sequence : MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 39.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.

Function : TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.

Involvement in disease :

Subcellular location : Nucleus

Protein Families : TFIIA subunit 2 family

Tissue Specificity :

Paythway :

Uniprot ID : P52657