Product Description
Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: TGFB1
Alternative Names : Transforming Growth Factor Beta-1; TGF-Beta-1; Latency-Associated Peptide; LAP; TGFB1; TGFB
Expression Region : 279-390aa
AA Sequence : ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Sequence Info : Partial
Tag Info : Tag-Free
Theoretical MW : 12.8 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 50mM Glycine-HCl, 150mMNacl, pH2.5
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is less than 0.2 ng/ml
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Transforming Growth Factor ?-1 (TGF?-1) is a secreted protein which belongs to the TGF-? family. TGF?-1 is abundantly expressed in bone, articular cartilage and chondrocytes and is increased in osteoarthritis (OA). TGF?-1 performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. The precursor is cleaved into a latency-associated peptide (LAP) and a mature TGF?-1 peptide. TGF?-1 may also form heterodimers with other TGF? family members. It has been found that TGF?-1 is frequently upregulated in tumor cells. Mutations in this gene results in Camurati-Engelmann disease.
Function : Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP)
Involvement in disease : Camurati-Engelmann disease (CAEND)
Subcellular location : Secreted, extracellular space, extracellular matrix
Protein Families : TGF-beta family
Tissue Specificity : Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Colocalizes with ASPN in chondrocytes within OA lesions of articular cartilage.
Paythway : Hipposignalingpathway
Uniprot ID : P01137
 Euro
 Euro
             British Pound
 British Pound
             US Dollar
 US Dollar
             
             
                 
       
           
           
           
           
          