Product Description
Recombinant Human Transforming growth factor beta-3 (TGFB3), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: TGFB3
Alternative Names : Transforming growth factor beta-3;TGFB3;TGF-beta-3;Latency-associated peptide;LAP
Expression Region : 301-412aa(Y340F)
AA Sequence : ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Sequence Info : Partial
Tag Info : Tag-Free
Theoretical MW : 12.7 kDa
Storage Buffer : Lyophilized from a 0.2 ?m Filtered 4 mM HCl
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is less than 2 ng/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Transforming growth factor beta 3(TGFB3) is a member of a TGF -? superfamily which is defined by theirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form of TGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subset ofintegrins. It binds with high affinity to TGF- ? RII, a type II serine/threonine kinase receptor. TGFB3 is involved incell differentiation, embryogenesis and development.It is believed to regulate molecules involved in cellularadhesion and extracellular matrix (ECM) formation during the process of palate development. Without TGF-?3,mammals develop a deformity known as a cleft palate.
Function : Involved in embryogenesis and cell differentiation.
Involvement in disease : Arrhythmogenic right ventricular dysplasia, familial, 1 (ARVD1); Loeys-Dietz syndrome 5 (LDS5)
Subcellular location : Secreted
Protein Families : TGF-beta family
Tissue Specificity :
Paythway : Hipposignalingpathway
Uniprot ID : P10600
 Euro
 Euro
             British Pound
 British Pound
             US Dollar
 US Dollar
             
             
                 
       
           
           
           
           
          