Recombinant Human Transforming growth factor beta-3 (TGFB3), partial (Active)

Product Description

Recombinant Human Transforming growth factor beta-3 (TGFB3), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: TGFB3

Alternative Names : Transforming growth factor beta-3;TGFB3;TGF-beta-3;Latency-associated peptide;LAP

Expression Region : 301-412aa(Y340F)

AA Sequence : ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS

Sequence Info : Partial

Tag Info : Tag-Free

Theoretical MW : 12.7 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 4 mM HCl

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is less than 2 ng/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Transforming growth factor beta 3(TGFB3) is a member of a TGF -? superfamily which is defined by theirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form of TGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subset ofintegrins. It binds with high affinity to TGF- ? RII, a type II serine/threonine kinase receptor. TGFB3 is involved incell differentiation, embryogenesis and development.It is believed to regulate molecules involved in cellularadhesion and extracellular matrix (ECM) formation during the process of palate development. Without TGF-?3,mammals develop a deformity known as a cleft palate.

Function : Involved in embryogenesis and cell differentiation.

Involvement in disease : Arrhythmogenic right ventricular dysplasia, familial, 1 (ARVD1); Loeys-Dietz syndrome 5 (LDS5)

Subcellular location : Secreted

Protein Families : TGF-beta family

Tissue Specificity :

Paythway : Hipposignalingpathway

Uniprot ID : P10600