Recombinant Human Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial

Product Description

Recombinant Human Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial is available at Gentaur for Next week Delivery.

Gene Name: TRPA1

Alternative Names : Ankyrin-like with transmembrane domains protein 1 Transformation-sensitive protein p120

Expression Region : 957-1119aa

AA Sequence : IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 35.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function (PubMed:25389312, PubMed:25855297). Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of volatile irritants, such as mustard oil, cinnamaldehyde, garlic and acrolein, an irritant from tears gas and vehicule exhaust fumes (PubMed:25389312, PubMed:20547126). Is also activated by menthol (in vitro)(PubMed:25389312). Acts also as a ionotropic cannabinoid receptor by being activated by delta(9)-tetrahydrocannabinol (THC), the psychoactive component of marijuana (PubMed:25389312). May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system (By similarity).

Function : Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function

Involvement in disease : Episodic pain syndrome, familial, 1 (FEPS1)

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : Transient receptor (TC 1.A.4) family

Tissue Specificity : Expressed at very low level. Expressed at very low level in human fibroblasts and at a moderate level in liposarcoma cells.

Paythway :

Uniprot ID : O75762