Recombinant Human Transmembrane emp24 domain-containing protein 9 (GP25L2), partial

Product Description

Recombinant Human Transmembrane emp24 domain-containing protein 9 (GP25L2), partial is available at Gentaur for Next week Delivery.

Gene Name: GP25L2

Alternative Names : GMP25Glycoprotein 25L2p24 family protein alpha-2;p24alpha2p25

Expression Region : 40-197aa

AA Sequence : FHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSE

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 45.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway. In COPI vesicle-mediated retrograde transport involved in the coatomer recruitment to mbranes of the early secretory pathway. Increases coatomer-dependent activity of ARFGAP2. Thought to play a crucial role in the specific retention of p24 complexes in cis-Golgi mbranes; specifically contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. May be involved in organization of intracellular mbranes, such as of the ER-Golgi intermediate compartment and the Golgi apparatus. Involved in ER localization of PTPN2 isoform PTPB.

Function : Appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway. In COPI vesicle-mediated retrograde transport involved in the coatomer recruitment to membranes of the early secretory pathway. Increases coatomer-dependent activity of ARFGAP2. Thought to play a crucial role in the specific retention of p24 complexes in cis-Golgi membranes; specifically contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. May be involved in organization of intracellular membranes, such as of the ER-Golgi intermediate compartment and the Golgi apparatus. Involved in ER localization of PTPN2 isoform PTPB.

Involvement in disease :

Subcellular location : Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus, cis-Golgi network membrane, Single-pass type I membrane protein, Endoplasmic reticulum-Golgi intermediate compartment membrane, Single-pass type I membrane protein, Golgi apparatus, trans-Golgi network membrane, Single-pass type I membrane protein

Protein Families : EMP24/GP25L family

Tissue Specificity :

Paythway :

Uniprot ID : Q9BVK6