Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial

Product Description

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial is available at Gentaur for Next week Delivery.

Gene Name: TREM2

Alternative Names : Triggering receptor expressed on monocytes 2

Expression Region : 19-174aa

AA Sequence : HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 19.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells.

Function : Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines.

Involvement in disease : Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL)

Subcellular location : Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted, SUBCELLULAR LOCATION: Isoform 3: Secreted

Protein Families :

Tissue Specificity : Expressed on macrophages and dendritic cells but not on granulocytes or monocytes. In the CNS strongest expression seen in the basal ganglia, corpus callosum, medulla oblongata and spinal cord.

Paythway : Osteoclastdifferentiation

Uniprot ID : Q9NZC2