Recombinant Human Trimethyllysine dioxygenase, mitochondrial (TMLHE)

Product Description

Recombinant Human Trimethyllysine dioxygenase, mitochondrial (TMLHE) is available at Gentaur for Next week Delivery.

Gene Name: TMLHE

Alternative Names : Epsilon-trimethyllysine 2-oxoglutarate dioxygenase;Epsilon-trimethyllysine hydroxylaseTML hydroxylaseTML-alpha-ketoglutarate dioxygenase;TML dioxygenase;TMLD

Expression Region : 16-376aa

AA Sequence : LLKGGVIYPALPQPNFKSLLPLAVHWHHTASKSLTCAWQQHEDHFELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDETTLFFTWPDGHVTKYDLNWLVKNSYEGQKQKVIQPRILWNAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRLFKEKQNTVNRQWNSSLQCDIPERILTYRHFVSGTSIEHRGSLI

Sequence Info : Full Length of Isoform 4

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 46.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Converts trimethyllysine (TML) into hydroxytrimethyllysine (HTML).

Function : Converts trimethyllysine (TML) into hydroxytrimethyllysine (HTML)

Involvement in disease : Autism, X-linked 6 (AUTSX6)

Subcellular location : Mitochondrion matrix

Protein Families : Gamma-BBH/TMLD family

Tissue Specificity : All isoforms, but isoform 8, are widely expressed in adult and fetal tissues. Isoform 8 is restricted to heart and skeletal muscle.

Paythway :

Uniprot ID : Q9NVH6