Recombinant Human Tubulin polymerization-promoting protein (TPPP)

Product Description

Recombinant Human Tubulin polymerization-promoting protein (TPPP) is available at Gentaur for Next week Delivery.

Gene Name: TPPP

Alternative Names : 25KDA brain-specific protein TPPP/p25 p24 p25-alpha

Expression Region : 1-219aa

AA Sequence : MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 50.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity of the microtubule network. May play a role in mitotic spindle assembly and nuclear envelope breakdown.

Function : May play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity of the microtubule network. May play a role in mitotic spindle assembly and nuclear envelope breakdown.

Involvement in disease :

Subcellular location : Cytoplasm, Cytoplasm, cytoskeleton, Nucleus

Protein Families : TPPP family

Tissue Specificity : Widely expressed.

Paythway :

Uniprot ID : O94811