Recombinant Human Tubulin-specific chaperone cofactor E-like protein (TBCEL)

Product Description

Recombinant Human Tubulin-specific chaperone cofactor E-like protein (TBCEL) is available at Gentaur for Next week Delivery.

Gene Name: TBCEL

Alternative Names : Leucine-rich repeat-containing protein 35

Expression Region : 1-424aa

AA Sequence : MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 64.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Acts as a regulator of tubulin stability.

Function : Acts as a regulator of tubulin stability.

Involvement in disease :

Subcellular location : Cytoplasm, cytoskeleton

Protein Families :

Tissue Specificity : Abundantly expressed in testis, but is also present in several tissues at a much lower level.

Paythway :

Uniprot ID : Q5QJ74