Product Description
Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15) (Active) is available at Gentaur for Next week Delivery.
Gene Name: TNFSF15
Alternative Names : Tumor Necrosis Factor Ligand Superfamily Member 15; TNF Ligand-Related Molecule 1; Vascular Endothelial Cell Growth Inhibitor; TNFSF15; TL1; VEGI
Expression Region : 1-192aa
AA Sequence : MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Sequence Info : Full Length of Isoform 2
Tag Info : Tag-Free
Theoretical MW : 21.86 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 250 mM NaCl, pH 7.5
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined in a cell proliferation assay using HUVEC cells is typically 5 ug/mL.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF15) is a new member of the tumor necrosis factor family. TNFSF15 is predominantly an endothelial cell-specific gene, and recombinant TNFSF15 is a potent inhibitor of endothelial cell proliferation, angiogenesis and tumor growth. TNFSF15 exerts two activities on endothelial cells: early G1 arrest of G0/G1-cells responding to growth stimuli and programmed cell death of proliferating cells. These activities are highly specific to endothelial cells. TNFSF15 is also able to regulate the expression of several important genes involved in angiogenesis. These findings are consistent with the view that TNFSF15 functions as an autocrine cytokine to inhibit angiogenesis and stabilize the vasculature.
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : O95150-2
Euro
British Pound
US Dollar