Recombinant Human Tumor necrosis factor ligand superfamily member 9 protein (TNFSF9), partial

Product Description

Recombinant Human Tumor necrosis factor ligand superfamily member 9 protein (TNFSF9), partial is available at Gentaur for Next week Delivery.

Gene Name: TNFSF9

Alternative Names : 4-1BB ligand receptorCDw137T-cell antigen 4-1BB homologT-cell antigen ILA; CD137

Expression Region : 52-254aa

AA Sequence : PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 25.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.

Function : Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.

Involvement in disease :

Subcellular location : Membrane, Single-pass type II membrane protein

Protein Families : Tumor necrosis factor family

Tissue Specificity : Expressed in brain, placenta, lung, skeletal muscle and kidney.

Paythway :

Uniprot ID : P41273