Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial

Product Description

Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial is available at Gentaur for Next week Delivery.

Gene Name: LTBR

Alternative Names : Lymphotoxin-beta receptorTumor necrosis factor C receptorTumor necrosis factor receptor 2-related protein;Tumor necrosis factor receptor type III;TNF-RIII;TNFR-III

Expression Region : 31-224aa

AA Sequence : QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 25.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.

Function : Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity :

Paythway : HIF-1signalingpathway

Uniprot ID : P36941