Product Description
Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial is available at Gentaur for Next week Delivery.
Gene Name: LTBR
Alternative Names : Lymphotoxin-beta receptorTumor necrosis factor C receptorTumor necrosis factor receptor 2-related protein;Tumor necrosis factor receptor type III;TNF-RIII;TNFR-III
Expression Region : 31-224aa
AA Sequence : QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT
Sequence Info : Extracellular Domain
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 25.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.
Function : Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.
Involvement in disease :
Subcellular location : Membrane, Single-pass type I membrane protein
Protein Families :
Tissue Specificity :
Paythway : HIF-1signalingpathway
Uniprot ID : P36941
Euro
British Pound
US Dollar