Recombinant Human Type-1 angiotensin II receptor (AGTR1), partial

Product Description

Recombinant Human Type-1 angiotensin II receptor (AGTR1), partial is available at Gentaur for Next week Delivery.

Gene Name: AGTR1

Alternative Names : AT1ARAT1BRAngiotensin II type-1 receptor;AT1

Expression Region : 297-359aa

AA Sequence : LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 9.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger syst.

Function : Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Involvement in disease : Renal tubular dysgenesis (RTD)

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : G-protein coupled receptor 1 family

Tissue Specificity : Liver, lung, adrenal and adrenocortical adenomas.

Paythway : Calciumsignalingpathway

Uniprot ID : P30556