Product Description
Recombinant Human Type-1 angiotensin II receptor (AGTR1), partial is available at Gentaur for Next week Delivery.
Gene Name: AGTR1
Alternative Names : AT1ARAT1BRAngiotensin II type-1 receptor;AT1
Expression Region : 297-359aa
AA Sequence : LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 9.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger syst.
Function : Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Involvement in disease : Renal tubular dysgenesis (RTD)
Subcellular location : Cell membrane, Multi-pass membrane protein
Protein Families : G-protein coupled receptor 1 family
Tissue Specificity : Liver, lung, adrenal and adrenocortical adenomas.
Paythway : Calciumsignalingpathway
Uniprot ID : P30556
 Euro
 Euro
             British Pound
 British Pound
             US Dollar
 US Dollar
             
             
                 
       
           
           
           
           
          