Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial

Product Description

Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial is available at Gentaur for Next week Delivery.

Gene Name: ROR1

Alternative Names : Neurotrophic tyrosine kinase, receptor-related 1

Expression Region : 30-391aa

AA Sequence : QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 42.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Tyrosine-protein kinase receptor whose role is not yet clear.

Function : Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo

Involvement in disease : Deafness, autosomal recessive, 108 (DFNB108)

Subcellular location : Membrane, Single-pass type I membrane protein, Cell projection, axon

Protein Families : Protein kinase superfamily, Tyr protein kinase family, ROR subfamily

Tissue Specificity : Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.

Paythway :

Uniprot ID : Q01973